Anti SPDL1 pAb (ATL-HPA048146 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048146-25

• 

Protein Description: spindle apparatus coiled-coil protein 1
Gene Name: SPDL1
Alternative Gene Name: CCDC99, FLJ20364, hSpindly
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069910: 77%, ENSRNOG00000007292: 79%
Entrez Gene ID: 54908
Uniprot ID: Q96EA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQIATLLQMKGSQTEFEQQERLLAMLEQKNGEIKHLLGEIRNLEKFKNLYDSMESKPSVDSGTLEDNTYYTDLLQMKLDNLNKEIESTKGELS
• Gene Sequence: LQIATLLQMKGSQTEFEQQERLLAMLEQKNGEIKHLLGEIRNLEKFKNLYDSMESKPSVDSGTLEDNTYYTDLLQMKLDNLNKEIESTKGELS
• Gene ID - Mouse: ENSMUSG00000069910
• Gene ID - Rat: ENSRNOG00000007292
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.