Anti SPATS2L pAb (ATL-HPA055427)

Atlas Antibodies

Catalog No.: ATL-HPA055427-25

Protein Description: spermatogenesis associated, serine-rich 2-like
Gene Name: SPATS2L
Alternative Gene Name: DNAPTP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038305: 85%, ENSRNOG00000016012: 86%
Entrez Gene ID: 26010
Uniprot ID: Q9NUQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPSKALRGVTEGNRLLQQKLSLDGNPKPIHGTTERSDGLQWSAEQPCNPSKPKAKTSPVKSNTPAAHLEIKPDELAKKR
• Gene Sequence: EPSKALRGVTEGNRLLQQKLSLDGNPKPIHGTTERSDGLQWSAEQPCNPSKPKAKTSPVKSNTPAAHLEIKPDELAKKR
• Gene ID - Mouse: ENSMUSG00000038305
• Gene ID - Rat: ENSRNOG00000016012
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.