Anti SPATA7 pAb (ATL-HPA038082 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038082-25

Protein Description: spermatogenesis associated 7
Gene Name: SPATA7
Alternative Gene Name: HSD3, LCA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021007: 56%, ENSRNOG00000003955: 55%
Entrez Gene ID: 55812
Uniprot ID: Q9P0W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGV
• Gene Sequence: RHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGV
• Gene ID - Mouse: ENSMUSG00000021007
• Gene ID - Rat: ENSRNOG00000003955
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.