Anti SPATA24 pAb (ATL-HPA044000 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044000-25

Protein Description: spermatogenesis associated 24
Gene Name: SPATA24
Alternative Gene Name: CCDC161, T6441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024352: 94%, ENSRNOG00000019976: 95%
Entrez Gene ID: 202051
Uniprot ID: Q86W54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESQEELIHQLRNVMVLQDENFVSKEEFQAVEKKLVEEKAAHAKTKVLLAKEEEKLQFALGEVEVLSKQLEKEKLAFEKALSSVKSKVLQESSKKDQLIT
• Gene Sequence: ESQEELIHQLRNVMVLQDENFVSKEEFQAVEKKLVEEKAAHAKTKVLLAKEEEKLQFALGEVEVLSKQLEKEKLAFEKALSSVKSKVLQESSKKDQLIT
• Gene ID - Mouse: ENSMUSG00000024352
• Gene ID - Rat: ENSRNOG00000019976
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.