Anti SPARC pAb (ATL-HPA002989 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002989-25

Protein Description: secreted protein, acidic, cysteine-rich (osteonectin)
Gene Name: SPARC
Alternative Gene Name: ON
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018593: 96%, ENSRNOG00000012840: 96%
Entrez Gene ID: 6678
Uniprot ID: P09486
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
• Gene Sequence: VLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
• Gene ID - Mouse: ENSMUSG00000018593
• Gene ID - Rat: ENSRNOG00000012840
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPARC pAb (ATL-HPA002989 w/enhanced validation) – 3 Found

Boneva, Stefaniya Konstantinova; Wolf, Julian; Hajdú, Rozina Ida; Prinz, Gabriele; Salié, Henrike; Schlecht, Anja; Killmer, Saskia; Laich, Yannik; Faatz, Henrik; Lommatzsch, Albrecht; Busch, Martin; Bucher, Felicitas; Stahl, Andreas; Böhringer, Daniel; Bengsch, Bertram; Schlunck, Günther; Agostini, Hansjürgen; Lange, Clemens A K. In-Depth Molecular Characterization of Neovascular Membranes Suggests a Role for Hyalocyte-to-Myofibroblast Transdifferentiation in Proliferative Diabetic Retinopathy. Frontiers In Immunology. 12( 34795670):757607. 

Wolf, Julian; Hajdu, Rozina Ida; Boneva, Stefaniya; Schlecht, Anja; Lapp, Thabo; Wacker, Katrin; Agostini, Hansjürgen; Reinhard, Thomas; Auw-Hädrich, Claudia; Schlunck, Günther; Lange, Clemens. Characterization of the Cellular Microenvironment and Novel Specific Biomarkers in Pterygia Using RNA Sequencing. Frontiers In Medicine. 8( 35174178):714458. 

Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.