Anti SPAM1 pAb (ATL-HPA017984 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017984-25

Protein Description: sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
Gene Name: SPAM1
Alternative Gene Name: HYAL5, PH-20, SPAG15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029678: 59%, ENSRNOG00000039466: 54%
Entrez Gene ID: 6677
Uniprot ID: P38567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPM
• Gene Sequence: CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPM
• Gene ID - Mouse: ENSMUSG00000029678
• Gene ID - Rat: ENSRNOG00000039466
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.