Anti SPAG7 pAb (ATL-HPA052394)

Atlas Antibodies

Catalog No.: ATL-HPA052394-25

Protein Description: sperm associated antigen 7
Gene Name: SPAG7
Alternative Gene Name: ACRP, FSA-1, MGC20134
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018287: 97%, ENSRNOG00000004246: 96%
Entrez Gene ID: 9552
Uniprot ID: O75391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDDCRYVMIFKKEFAPSDEELDSYRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVVVSPASDYKDKYSHLIGKGAAKDAAHMLQANKTYGC
• Gene Sequence: DDDCRYVMIFKKEFAPSDEELDSYRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVVVSPASDYKDKYSHLIGKGAAKDAAHMLQANKTYGC
• Gene ID - Mouse: ENSMUSG00000018287
• Gene ID - Rat: ENSRNOG00000004246
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.