Anti SPAG16 pAb (ATL-HPA037542)

Atlas Antibodies

Catalog No.: ATL-HPA037542-25

Protein Description: sperm associated antigen 16
Gene Name: SPAG16
Alternative Gene Name: DKFZp666P1710, FLJ22724, PF20, WDR29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053153: 89%, ENSRNOG00000054475: 90%
Entrez Gene ID: 79582
Uniprot ID: Q8N0X2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVG
• Gene Sequence: NLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVG
• Gene ID - Mouse: ENSMUSG00000053153
• Gene ID - Rat: ENSRNOG00000054475
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.