Anti SOX17 pAb (ATL-HPA068399 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA068399-25

Protein Description: SRY (sex determining region Y)-box 17
Gene Name: SOX17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025902: 89%, ENSRNOG00000027357: 87%
Entrez Gene ID: 64321
Uniprot ID: Q9H6I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGE
• Gene Sequence: MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGE
• Gene ID - Mouse: ENSMUSG00000025902
• Gene ID - Rat: ENSRNOG00000027357
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.