Anti SOX13 pAb (ATL-HPA054843)

Atlas Antibodies

SKU: ATL-HPA054843-25

• 

Protein Description: SRY (sex determining region Y)-box 13
Gene Name: SOX13
Alternative Gene Name: ICA12, MGC117216, Sox-13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070643: 93%, ENSRNOG00000028353: 87%
Entrez Gene ID: 9580
Uniprot ID: Q9UN79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPLEEAMLSCDMDGSRHFPESRNSSHI
• Gene Sequence: QDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPLEEAMLSCDMDGSRHFPESRNSSHI
• Gene ID - Mouse: ENSMUSG00000070643
• Gene ID - Rat: ENSRNOG00000028353
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.