Anti SOAT1 pAb (ATL-HPA047171 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA047171-25

Protein Description: sterol O-acyltransferase 1
Gene Name: SOAT1
Alternative Gene Name: ACAT, SOAT, STAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026600: 59%, ENSRNOG00000004111: 67%
Entrez Gene ID: 6646
Uniprot ID: P35610
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPF
• Gene Sequence: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPF
• Gene ID - Mouse: ENSMUSG00000026600
• Gene ID - Rat: ENSRNOG00000004111
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.