Anti SNX20 pAb (ATL-HPA043649 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043649-25

Protein Description: sorting nexin 20
Gene Name: SNX20
Alternative Gene Name: SLIC-1, SLIC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031662: 64%, ENSRNOG00000014202: 60%
Entrez Gene ID: 124460
Uniprot ID: Q7Z614
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGCMGPITQCTARTQQEAPATGPDLLHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASAR
• Gene Sequence: PGCMGPITQCTARTQQEAPATGPDLLHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASAR
• Gene ID - Mouse: ENSMUSG00000031662
• Gene ID - Rat: ENSRNOG00000014202
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.