Anti SNCB pAb (ATL-HPA035876 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035876-25
![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Cerebral Cortex tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/88896/162062/atl-hpa035876_anti-sncb-pab-atl-hpa035876-wenhanced-validation_43701__59775.1681113988.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Cerebral Cortex tissue")
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SNCB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034891: 97%, ENSRNOG00000018039: 97%
Entrez Gene ID: 6620
Uniprot ID: Q16143
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA |
| Gene Sequence | GNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA |
| Gene ID - Mouse | ENSMUSG00000034891 |
| Gene ID - Rat | ENSRNOG00000018039 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SNCB pAb (ATL-HPA035876 w/enhanced validation) | |
| Datasheet | Anti SNCB pAb (ATL-HPA035876 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SNCB pAb (ATL-HPA035876 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SNCB pAb (ATL-HPA035876 w/enhanced validation) | |
| Datasheet | Anti SNCB pAb (ATL-HPA035876 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SNCB pAb (ATL-HPA035876 w/enhanced validation) |
| Citations for Anti SNCB pAb (ATL-HPA035876 w/enhanced validation) – 1 Found |
| Bergström, Sofia; Remnestål, Julia; Yousef, Jamil; Olofsson, Jennie; Markaki, Ioanna; Carvalho, Stephanie; Corvol, Jean-Christophe; Kultima, Kim; Kilander, Lena; Löwenmark, Malin; Ingelsson, Martin; Blennow, Kaj; Zetterberg, Henrik; Nellgård, Bengt; Brosseron, Frederic; Heneka, Michael T; Bosch, Beatriz; Sanchez-Valle, Raquel; Månberg, Anna; Svenningsson, Per; Nilsson, Peter. Multi-cohort profiling reveals elevated CSF levels of brain-enriched proteins in Alzheimer's disease. Annals Of Clinical And Translational Neurology. 2021;8(7):1456-1470. PubMed |