Anti SNAPC4 pAb (ATL-HPA046627)

Atlas Antibodies

Catalog No.: ATL-HPA046627-25

Protein Description: small nuclear RNA activating complex, polypeptide 4, 190kDa
Gene Name: SNAPC4
Alternative Gene Name: FLJ13451, PTFalpha, SNAP190
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036281: 60%, ENSRNOG00000018845: 62%
Entrez Gene ID: 6621
Uniprot ID: Q5SXM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRVPLLGSRLPYQPPALCSLRALSGLLLHKKALEHKATSLVVGGEAERPAGALQASLGLVRGQLQDNPAYLLLRARFLAAFTLPALLATLAPQGVRTTLSVPSRVGSESEDEDLLSELELA
• Gene Sequence: VRVPLLGSRLPYQPPALCSLRALSGLLLHKKALEHKATSLVVGGEAERPAGALQASLGLVRGQLQDNPAYLLLRARFLAAFTLPALLATLAPQGVRTTLSVPSRVGSESEDEDLLSELELA
• Gene ID - Mouse: ENSMUSG00000036281
• Gene ID - Rat: ENSRNOG00000018845
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.