Anti SNAPC2 pAb (ATL-HPA077597)

Atlas Antibodies

Catalog No.: ATL-HPA077597-25

Protein Description: small nuclear RNA activating complex polypeptide 2
Gene Name: SNAPC2
Alternative Gene Name: PTFdelta, SNAP45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011837: 61%, ENSRNOG00000001056: 66%
Entrez Gene ID: 6618
Uniprot ID: Q13487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVL
• Gene Sequence: APSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVL
• Gene ID - Mouse: ENSMUSG00000011837
• Gene ID - Rat: ENSRNOG00000001056
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.