Anti SMURF2 pAb (ATL-HPA071508)

Atlas Antibodies

Catalog No.: ATL-HPA071508-25

Protein Description: SMAD specific E3 ubiquitin protein ligase 2
Gene Name: SMURF2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018363: 96%, ENSRNOG00000014623: 98%
Entrez Gene ID: 64750
Uniprot ID: Q9HAU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD
• Gene Sequence: LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD
• Gene ID - Mouse: ENSMUSG00000018363
• Gene ID - Rat: ENSRNOG00000014623
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.