Anti SMG6 pAb (ATL-HPA042932)

Atlas Antibodies

Catalog No.: ATL-HPA042932-25

Protein Description: SMG6 nonsense mediated mRNA decay factor
Gene Name: SMG6
Alternative Gene Name: C17orf31, EST1A, KIAA0732, SMG-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038290: 84%, ENSRNOG00000003041: 85%
Entrez Gene ID: 23293
Uniprot ID: Q86US8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEGLERVRISASELRGILATLAPQAGSRENMKELKEARPRKDNRRPDLEIYKPGLSRLRNKPKIKEPPGSEEFKDEIVNDRDCSAVENGTQPVKDVCKELNNQEQNGPIDP
• Gene Sequence: MAEGLERVRISASELRGILATLAPQAGSRENMKELKEARPRKDNRRPDLEIYKPGLSRLRNKPKIKEPPGSEEFKDEIVNDRDCSAVENGTQPVKDVCKELNNQEQNGPIDP
• Gene ID - Mouse: ENSMUSG00000038290
• Gene ID - Rat: ENSRNOG00000003041
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.