Anti SMAGP pAb (ATL-HPA039711 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039711-25

Protein Description: small cell adhesion glycoprotein
Gene Name: SMAGP
Alternative Gene Name: hSMAGP, MGC149453, MGC149454
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053559: 87%, ENSRNOG00000048932: 87%
Entrez Gene ID: 57228
Uniprot ID: Q0VAQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI
• Gene Sequence: YKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI
• Gene ID - Mouse: ENSMUSG00000053559
• Gene ID - Rat: ENSRNOG00000048932
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SMAGP pAb (ATL-HPA039711 w/enhanced validation) – 1 Found

Gao, Xia; Bali, Aman S; Randell, Scott H; Hogan, Brigid L M. GRHL2 coordinates regeneration of a polarized mucociliary epithelium from basal stem cells. The Journal Of Cell Biology. 2015;211(3):669-82.