Anti SLTM pAb (ATL-HPA040256)

Atlas Antibodies

Catalog No.: ATL-HPA040256-25

Protein Description: SAFB-like, transcription modulator
Gene Name: SLTM
Alternative Gene Name: FLJ13213, Met
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032212: 96%, ENSRNOG00000054446: 96%
Entrez Gene ID: 79811
Uniprot ID: Q9NWH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAEDDNISVTIQAEDAITLDFDGDDLLETGKNVKITDSEASKPKDGQ
• Gene Sequence: GEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAEDDNISVTIQAEDAITLDFDGDDLLETGKNVKITDSEASKPKDGQ
• Gene ID - Mouse: ENSMUSG00000032212
• Gene ID - Rat: ENSRNOG00000054446
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.