Anti SLITRK1 pAb (ATL-HPA074835 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA074835-25

Protein Description: SLIT and NTRK like family member 1
Gene Name: SLITRK1
Alternative Gene Name: KIAA1910, LRRC12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075478: 99%, ENSRNOG00000009209: 99%
Entrez Gene ID: 114798
Uniprot ID: Q96PX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ECSCTIVPFKQWAERLGSEVLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSIS
• Gene Sequence: ECSCTIVPFKQWAERLGSEVLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSIS
• Gene ID - Mouse: ENSMUSG00000075478
• Gene ID - Rat: ENSRNOG00000009209
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.