Anti SLC9A7 pAb (ATL-HPA075385)

Atlas Antibodies

SKU: ATL-HPA075385-25

• 

Protein Description: solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7
Gene Name: SLC9A7
Alternative Gene Name: NHE7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037341: 90%, ENSRNOG00000004150: 91%
Entrez Gene ID: 84679
Uniprot ID: Q96T83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SWLNIRVGVEEPSEEDQNEHHWQYFRVGVDPDQDPPPNNDSFQVLQGDGPDSARGNRTKQESAWIFRLWY
• Gene Sequence: SWLNIRVGVEEPSEEDQNEHHWQYFRVGVDPDQDPPPNNDSFQVLQGDGPDSARGNRTKQESAWIFRLWY
• Gene ID - Mouse: ENSMUSG00000037341
• Gene ID - Rat: ENSRNOG00000004150
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.