Anti SLC9A3 pAb (ATL-HPA036493 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036493-25

Protein Description: solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3
Gene Name: SLC9A3
Alternative Gene Name: NHE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036123: 93%, ENSRNOG00000015159: 93%
Entrez Gene ID: 6550
Uniprot ID: P48764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQSLEQRRRSIRDAEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTM
• Gene Sequence: TDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQSLEQRRRSIRDAEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTM
• Gene ID - Mouse: ENSMUSG00000036123
• Gene ID - Rat: ENSRNOG00000015159
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.