Anti SLC7A9 pAb (ATL-HPA042591 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042591-25

Protein Description: solute carrier family 7 (amino acid transporter light chain, bo,+ system), member 9
Gene Name: SLC7A9
Alternative Gene Name: CSNU3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030492: 84%, ENSRNOG00000012344: 87%
Entrez Gene ID: 11136
Uniprot ID: P82251
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YKFGWAQKISKPITMHLQMLMEVVPPEEDPE
• Gene Sequence: YKFGWAQKISKPITMHLQMLMEVVPPEEDPE
• Gene ID - Mouse: ENSMUSG00000030492
• Gene ID - Rat: ENSRNOG00000012344
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.