Anti SLC7A4 pAb (ATL-HPA031023 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031023-25

Protein Description: solute carrier family 7, member 4
Gene Name: SLC7A4
Alternative Gene Name: CAT-4, HCAT3, VH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022756: 66%, ENSRNOG00000001874: 70%
Entrez Gene ID: 6545
Uniprot ID: O43246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIRHSKENQRELPGLNSTHYVVFPRGSLEETVQAMQPPSQAPAQDPGHME
• Gene Sequence: GIRHSKENQRELPGLNSTHYVVFPRGSLEETVQAMQPPSQAPAQDPGHME
• Gene ID - Mouse: ENSMUSG00000022756
• Gene ID - Rat: ENSRNOG00000001874
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.