Anti SLC6A4 pAb (ATL-HPA074728)

Atlas Antibodies

SKU: ATL-HPA074728-25

• 

Protein Description: solute carrier family 6 (neurotransmitter transporter), member 4
Gene Name: SLC6A4
Alternative Gene Name: 5-HTT, HTT, OCD1, SERT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020838: 90%, ENSRNOG00000003476: 88%
Entrez Gene ID: 6532
Uniprot ID: P31645
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI
• Gene Sequence: KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI
• Gene ID - Mouse: ENSMUSG00000020838
• Gene ID - Rat: ENSRNOG00000003476
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.