Anti SLC6A2 pAb (ATL-HPA076311 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA076311-25

• 

Protein Description: solute carrier family 6 member 2
Gene Name: SLC6A2
Alternative Gene Name: NAT1, NET, NET1, SLC6A5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055368: 85%, ENSRNOG00000032776: 32%
Entrez Gene ID: 6530
Uniprot ID: P23975
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLA
• Gene Sequence: MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLA
• Gene ID - Mouse: ENSMUSG00000055368
• Gene ID - Rat: ENSRNOG00000032776
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.