Anti SLC6A19 pAb (ATL-HPA043207 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043207-25

Protein Description: solute carrier family 6 (neutral amino acid transporter), member 19
Gene Name: SLC6A19
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021565: 84%, ENSRNOG00000026501: 87%
Entrez Gene ID: 340024
Uniprot ID: Q695T7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNK
• Gene Sequence: MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNK
• Gene ID - Mouse: ENSMUSG00000021565
• Gene ID - Rat: ENSRNOG00000026501
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.