Anti SLC6A16 pAb (ATL-HPA076812)

Atlas Antibodies

Catalog No.: ATL-HPA076812-25

Protein Description: solute carrier family 6, member 16
Gene Name: SLC6A16
Alternative Gene Name: NTT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094152: 66%, ENSRNOG00000025220: 66%
Entrez Gene ID: 28968
Uniprot ID: Q9GZN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP
• Gene Sequence: SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP
• Gene ID - Mouse: ENSMUSG00000094152
• Gene ID - Rat: ENSRNOG00000025220
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.