Anti SLC4A10 pAb (ATL-HPA076725 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA076725-25

Protein Description: solute carrier family 4 member 10
Gene Name: SLC4A10
Alternative Gene Name: NBCn2, NCBE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026904: 95%, ENSRNOG00000005307: 95%
Entrez Gene ID: 57282
Uniprot ID: Q6U841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSKGLGGQQKGHTSPCGMKQRHEKGPPHQQEREVDLH
• Gene Sequence: FSKGLGGQQKGHTSPCGMKQRHEKGPPHQQEREVDLH
• Gene ID - Mouse: ENSMUSG00000026904
• Gene ID - Rat: ENSRNOG00000005307
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.