Anti SLC44A1 pAb (ATL-HPA064714)

Atlas Antibodies

Catalog No.: ATL-HPA064714-25

Protein Description: solute carrier family 44 (choline transporter), member 1
Gene Name: SLC44A1
Alternative Gene Name: CD92, CDW92, CHTL1, CTL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028412: 95%, ENSRNOG00000055089: 95%
Entrez Gene ID: 23446
Uniprot ID: Q8WWI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFLCLAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADSRELKPMASGASS
• Gene Sequence: LFLCLAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADSRELKPMASGASS
• Gene ID - Mouse: ENSMUSG00000028412
• Gene ID - Rat: ENSRNOG00000055089
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.