Anti SLC3A1 pAb (ATL-HPA038360 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038360-100

Protein Description: solute carrier family 3 (amino acid transporter heavy chain), member 1
Gene Name: SLC3A1
Alternative Gene Name: ATR1, CSNU1, D2H, NBAT, RBAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024131: 81%, ENSRNOG00000007006: 82%
Entrez Gene ID: 6519
Uniprot ID: Q07837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNQYVNVMNMLLFTLPGTPITYYGEEIGMGNIVAANLNESYDINTLRSKSPMQWDNSSNAGFSEASNTWLPTNSDYHTVNVDVQKTQPRSALKLYQDLSLLHANELLLNRGWFCHLRNDSHYVVYTRELDGIDRIFIVVLNFGESTLLNL
• Gene Sequence: GNQYVNVMNMLLFTLPGTPITYYGEEIGMGNIVAANLNESYDINTLRSKSPMQWDNSSNAGFSEASNTWLPTNSDYHTVNVDVQKTQPRSALKLYQDLSLLHANELLLNRGWFCHLRNDSHYVVYTRELDGIDRIFIVVLNFGESTLLNL
• Gene ID - Mouse: ENSMUSG00000024131
• Gene ID - Rat: ENSRNOG00000007006
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC3A1 pAb (ATL-HPA038360 w/enhanced validation) – 2 Found

Lindström, Nils O; Tran, Tracy; Guo, Jinjin; Rutledge, Elisabeth; Parvez, Riana K; Thornton, Matthew E; Grubbs, Brendan; McMahon, Jill A; McMahon, Andrew P. Conserved and Divergent Molecular and Anatomic Features of Human and Mouse Nephron Patterning. Journal Of The American Society Of Nephrology : Jasn. 2018;29(3):825-840. 

Monteil, Vanessa; Kwon, Hyesoo; Prado, Patricia; Hagelkrüys, Astrid; Wimmer, Reiner A; Stahl, Martin; Leopoldi, Alexandra; Garreta, Elena; Hurtado Del Pozo, Carmen; Prosper, Felipe; Romero, Juan Pablo; Wirnsberger, Gerald; Zhang, Haibo; Slutsky, Arthur S; Conder, Ryan; Montserrat, Nuria; Mirazimi, Ali; Penninger, Josef M. Inhibition of SARS-CoV-2 Infections in Engineered Human Tissues Using Clinical-Grade Soluble Human ACE2. Cell. 2020;181(4):905-913.e7.