Anti SLC39A3 pAb (ATL-HPA042139 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042139-25

Protein Description: solute carrier family 39 (zinc transporter), member 3
Gene Name: SLC39A3
Alternative Gene Name: ZIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046822: 68%, ENSRNOG00000045524: 68%
Entrez Gene ID: 29985
Uniprot ID: Q9BRY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGL
• Gene Sequence: TFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGL
• Gene ID - Mouse: ENSMUSG00000046822
• Gene ID - Rat: ENSRNOG00000045524
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.