Anti SLC39A14 pAb (ATL-HPA056732 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA056732-25

Protein Description: solute carrier family 39 member 14
Gene Name: SLC39A14
Alternative Gene Name: KIAA0062, NET34, ZIP14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022094: 83%, ENSRNOG00000009832: 88%
Entrez Gene ID: 23516
Uniprot ID: Q15043
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVW
• Gene Sequence: STCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVW
• Gene ID - Mouse: ENSMUSG00000022094
• Gene ID - Rat: ENSRNOG00000009832
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.