Anti SLC38A2 pAb (ATL-HPA035180)

Atlas Antibodies

Catalog No.: ATL-HPA035180-25

Protein Description: solute carrier family 38, member 2
Gene Name: SLC38A2
Alternative Gene Name: ATA2, KIAA1382, SAT2, SNAT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022462: 96%, ENSRNOG00000006305: 93%
Entrez Gene ID: 54407
Uniprot ID: Q96QD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHP
• Gene Sequence: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHP
• Gene ID - Mouse: ENSMUSG00000022462
• Gene ID - Rat: ENSRNOG00000006305
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC38A2 pAb (ATL-HPA035180) – 2 Found

Jeon, Young Joo; Khelifa, Sihem; Ratnikov, Boris; Scott, David A; Feng, Yongmei; Parisi, Fabio; Ruller, Chelsea; Lau, Eric; Kim, Hyungsoo; Brill, Laurence M; Jiang, Tingting; Rimm, David L; Cardiff, Robert D; Mills, Gordon B; Smith, Jeffrey W; Osterman, Andrei L; Kluger, Yuval; Ronai, Ze'ev A. Regulation of glutamine carrier proteins by RNF5 determines breast cancer response to ER stress-inducing chemotherapies. Cancer Cell. 2015;27(3):354-69. 

Kandasamy, Palanivel; Zlobec, Inti; Nydegger, Damian T; Pujol-Giménez, Jonai; Bhardwaj, Rajesh; Shirasawa, Senji; Tsunoda, Toshiyuki; Hediger, Matthias A. Oncogenic KRAS mutations enhance amino acid uptake by colorectal cancer cells via the hippo signaling effector YAP1. Molecular Oncology. 2021;15(10):2782-2800.