Anti SLC37A4 pAb (ATL-HPA038940 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038940-25

Protein Description: solute carrier family 37 (glucose-6-phosphate transporter), member 4
Gene Name: SLC37A4
Alternative Gene Name: G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032114: 87%, ENSRNOG00000011361: 87%
Entrez Gene ID: 2542
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NEPADVGLRNLDPMPSEGKKGSLKEESTLQE
• Gene Sequence: NEPADVGLRNLDPMPSEGKKGSLKEESTLQE
• Gene ID - Mouse: ENSMUSG00000032114
• Gene ID - Rat: ENSRNOG00000011361
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.