Anti SLC27A1 pAb (ATL-HPA076520)

Atlas Antibodies

SKU: ATL-HPA076520-25

• 

Protein Description: solute carrier family 27 member 1
Gene Name: SLC27A1
Alternative Gene Name: ACSVL5, FATP, FATP1, FLJ00336, MGC71751
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031808: 80%, ENSRNOG00000018170: 83%
Entrez Gene ID: 376497
Uniprot ID: Q6PCB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAF
• Gene Sequence: QREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAF
• Gene ID - Mouse: ENSMUSG00000031808
• Gene ID - Rat: ENSRNOG00000018170
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.