Anti SLC25A43 pAb (ATL-HPA035188)

Atlas Antibodies

Catalog No.: ATL-HPA035188-25

Protein Description: solute carrier family 25, member 43
Gene Name: SLC25A43
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037636: 89%, ENSRNOG00000012756: 89%
Entrez Gene ID: 203427
Uniprot ID: Q8WUT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQ
• Gene Sequence: ETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQ
• Gene ID - Mouse: ENSMUSG00000037636
• Gene ID - Rat: ENSRNOG00000012756
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC25A43 pAb (ATL-HPA035188) – 1 Found

Prosén, Sara; Eremo, Anna Göthlin; Tsegai, Alexander Duarte; Lindberg, Magnus; Tina, Elisabet. Decreased expression of the mitochondrial solute carrier SLC25A43 in basal cell carcinoma compared with healthy skin. Oncology Letters. 2017;14(2):2218-2222.