Anti SLC22A13 pAb (ATL-HPA035962 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035962-25

Protein Description: solute carrier family 22 (organic anion/urate transporter), member 13
Gene Name: SLC22A13
Alternative Gene Name: OAT10, OCTL1, OCTL3, ORCTL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074028: 80%, ENSRNOG00000056476: 83%
Entrez Gene ID: 9390
Uniprot ID: Q9Y226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRLPSLKNEFNLVCDR
• Gene Sequence: WVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRLPSLKNEFNLVCDR
• Gene ID - Mouse: ENSMUSG00000074028
• Gene ID - Rat: ENSRNOG00000056476
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.