Anti SLC20A1 pAb (ATL-HPA035834)

Atlas Antibodies

Catalog No.: ATL-HPA035834-25

Protein Description: solute carrier family 20 (phosphate transporter), member 1
Gene Name: SLC20A1
Alternative Gene Name: Glvr-1, GLVR1, PiT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027397: 77%, ENSRNOG00000018567: 78%
Entrez Gene ID: 6574
Uniprot ID: Q8WUM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDL
• Gene Sequence: KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDL
• Gene ID - Mouse: ENSMUSG00000027397
• Gene ID - Rat: ENSRNOG00000018567
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC20A1 pAb (ATL-HPA035834) – 1 Found

Hallén, Tobias; Johannsson, Gudmundur; Dahlén, Rahil; Glad, Camilla A M; Örndal, Charlotte; Engvall, Angelica; Carén, Helena; Skoglund, Thomas; Olsson, Daniel S. Genome-wide DNA Methylation Differences in Nonfunctioning Pituitary Adenomas With and Without Postsurgical Progression. The Journal Of Clinical Endocrinology And Metabolism. 2022;107(8):2318-2328.