Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA073224-25

Protein Description: solute carrier family 18 member A2
Gene Name: SLC18A2
Alternative Gene Name: SVAT, SVMT, VMAT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025094: 89%, ENSRNOG00000008890: 94%
Entrez Gene ID: 6571
Uniprot ID: Q05940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
• Gene Sequence: MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
• Gene ID - Mouse: ENSMUSG00000025094
• Gene ID - Rat: ENSRNOG00000008890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.