Anti SLC18A1 pAb (ATL-HPA063797 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA063797-25

Protein Description: solute carrier family 18 (vesicular monoamine transporter), member 1
Gene Name: SLC18A1
Alternative Gene Name: CGAT, VAT1, VMAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036330: 69%, ENSRNOG00000011992: 69%
Entrez Gene ID: 6570
Uniprot ID: P54219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
• Gene Sequence: KEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
• Gene ID - Mouse: ENSMUSG00000036330
• Gene ID - Rat: ENSRNOG00000011992
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.