Anti SLC17A7 pAb (ATL-HPA063679 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA063679-25

Protein Description: solute carrier family 17 member 7
Gene Name: SLC17A7
Alternative Gene Name: SLC17A7, BNPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070570: 94%, ENSRNOG00000020650: 94%
Entrez Gene ID: 57030
Uniprot ID: Q9P2U7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSISEEERKYIEDAIGESAKLMNPLTKFSTP
• Gene Sequence: PSISEEERKYIEDAIGESAKLMNPLTKFSTP
• Gene ID - Mouse: ENSMUSG00000070570
• Gene ID - Rat: ENSRNOG00000020650
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.