Anti SIPA1 pAb (ATL-HPA039867 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039867-25

Protein Description: signal-induced proliferation-associated 1
Gene Name: SIPA1
Alternative Gene Name: SPA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056917: 82%, ENSRNOG00000020726: 82%
Entrez Gene ID: 6494
Uniprot ID: Q96FS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPSGSEDKGNPAPELRASFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESM
• Gene Sequence: SPSGSEDKGNPAPELRASFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESM
• Gene ID - Mouse: ENSMUSG00000056917
• Gene ID - Rat: ENSRNOG00000020726
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.