Anti SIGLEC6 pAb (ATL-HPA018198 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018198-25

Protein Description: sialic acid binding Ig-like lectin 6
Gene Name: SIGLEC6
Alternative Gene Name: CD327, CD33L, CD33L1, OB-BP1, SIGLEC-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004609: 49%, ENSRNOG00000037331: 48%
Entrez Gene ID: 946
Uniprot ID: O43699
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGT
• Gene Sequence: LPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGT
• Gene ID - Mouse: ENSMUSG00000004609
• Gene ID - Rat: ENSRNOG00000037331
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SIGLEC6 pAb (ATL-HPA018198 w/enhanced validation) – 1 Found

Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84.