Anti SHMT1 pAb (ATL-HPA078682 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA078682-100
Immunohistochemistry analysis in human liver and cerebral cortex tissues using Anti-SHMT1 antibody. Corresponding SHMT1 RNA-seq data are presented for the same tissues.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: serine hydroxymethyltransferase 1
Gene Name: SHMT1
Alternative Gene Name: CSHMT, MGC15229, MGC24556, SHMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020534: 73%, ENSRNOG00000005275: 75%
Entrez Gene ID: 6470
Uniprot ID: P34896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF
Gene Sequence LQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF
Gene ID - Mouse ENSMUSG00000020534
Gene ID - Rat ENSRNOG00000005275
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SHMT1 pAb (ATL-HPA078682 w/enhanced validation)
Datasheet Anti SHMT1 pAb (ATL-HPA078682 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SHMT1 pAb (ATL-HPA078682 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SHMT1 pAb (ATL-HPA078682 w/enhanced validation)
Datasheet Anti SHMT1 pAb (ATL-HPA078682 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SHMT1 pAb (ATL-HPA078682 w/enhanced validation)
!