Anti SH3YL1 pAb (ATL-HPA030927)

Atlas Antibodies

Catalog No.: ATL-HPA030927-25

Protein Description: SH3 and SYLF domain containing 1
Gene Name: SH3YL1
Alternative Gene Name: DKFZP586F1318, Ray
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020669: 97%, ENSRNOG00000005522: 97%
Entrez Gene ID: 26751
Uniprot ID: Q96HL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVV
• Gene Sequence: MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVV
• Gene ID - Mouse: ENSMUSG00000020669
• Gene ID - Rat: ENSRNOG00000005522
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.