Anti SH3TC1 pAb (ATL-HPA038132)

Atlas Antibodies

Catalog No.: ATL-HPA038132-25

Protein Description: SH3 domain and tetratricopeptide repeats 1
Gene Name: SH3TC1
Alternative Gene Name: FLJ20356
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036553: 63%, ENSRNOG00000007993: 63%
Entrez Gene ID: 54436
Uniprot ID: Q8TE82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTVVMRPSVSWEKAGPEEAKAPVRGDEAPPARVAGPAAGTPPCQMGVYPTDLTLQLLAVRRKSRLRDPGLQQTLR
• Gene Sequence: RTVVMRPSVSWEKAGPEEAKAPVRGDEAPPARVAGPAAGTPPCQMGVYPTDLTLQLLAVRRKSRLRDPGLQQTLR
• Gene ID - Mouse: ENSMUSG00000036553
• Gene ID - Rat: ENSRNOG00000007993
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.