Anti SH3PXD2A pAb (ATL-HPA037923)

Atlas Antibodies

Catalog No.: ATL-HPA037923-25

Protein Description: SH3 and PX domains 2A
Gene Name: SH3PXD2A
Alternative Gene Name: FISH, KIAA0418, SH3MD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053617: 86%, ENSRNOG00000020353: 88%
Entrez Gene ID: 9644
Uniprot ID: Q5TCZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP
• Gene Sequence: PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP
• Gene ID - Mouse: ENSMUSG00000053617
• Gene ID - Rat: ENSRNOG00000020353
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SH3PXD2A pAb (ATL-HPA037923) – 1 Found

Pedersen, Nina Marie; Wenzel, Eva Maria; Wang, Ling; Antoine, Sandra; Chavrier, Philippe; Stenmark, Harald; Raiborg, Camilla. Protrudin-mediated ER-endosome contact sites promote MT1-MMP exocytosis and cell invasion. The Journal Of Cell Biology. 2020;219(8)