Anti SH3BP5 pAb (ATL-HPA036445 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036445-25

Protein Description: SH3-domain binding protein 5 (BTK-associated)
Gene Name: SH3BP5
Alternative Gene Name: Sab
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021892: 95%, ENSRNOG00000052391: 95%
Entrez Gene ID: 9467
Uniprot ID: O60239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLDLPSPVSLSEFGMMFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKANNNRG
• Gene Sequence: ETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLDLPSPVSLSEFGMMFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKANNNRG
• Gene ID - Mouse: ENSMUSG00000021892
• Gene ID - Rat: ENSRNOG00000052391
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.