Anti SF3A2 pAb (ATL-HPA049439 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA049439-25

Protein Description: splicing factor 3a, subunit 2, 66kDa
Gene Name: SF3A2
Alternative Gene Name: Prp11, PRPF11, SAP62, SF3a66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020211: 100%, ENSRNOG00000019349: 100%
Entrez Gene ID: 8175
Uniprot ID: Q15428
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVE
• Gene Sequence: SSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVE
• Gene ID - Mouse: ENSMUSG00000020211
• Gene ID - Rat: ENSRNOG00000019349
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.